Loading...
Statistics
Advertisement

Advancebit.com

Advertisement
Conversion Technology Metas Server
Advancebit.com is hosted in United States / Scottsdale . Advancebit.com doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: Html, Html5, Iframe, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Microsoft-IIS/7.5.

Technologies in use by Advancebit.com

Technology

Number of occurences: 3
  • Html
  • Html5
  • Iframe

Advertisement

Server Type

  • Microsoft-IIS/7.5

Powered by

  • ASP.NET

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Advancebit.com

Missing HTTPS protocol.

    Meta - Advancebit.com

    Number of occurences: 0

    Server / Hosting

    • IP: 184.168.221.58
    • Latitude: 33.61
    • Longitude: -111.89
    • Country: United States
    • City: Scottsdale

    Rname

    • ns41.domaincontrol.com
    • ns42.domaincontrol.com
    • mailstore1.secureserver.net
    • smtp.secureserver.net

    Target

    • dns.jomax.net

    HTTP Header Response

    HTTP/1.1 302 Found Cache-Control: no-cache Pragma: no-cache Content-Length: 155 Content-Type: text/html; charset=utf-8 Expires: -1 Location: /site.aspx?aspxerrorpath=/default.aspx Server: Microsoft-IIS/7.5 X-AspNet-Version: 4.0.30319 X-Powered-By: ASP.NET Date: Wed, 13 Apr 2016 11:28:21 GMT Age: 1 Connection: keep-alive HTTP/1.1 200 OK Cache-Control: private Content-Length: 453 Content-Type: text/html; charset=utf-8 Server: Microsoft-IIS/7.5 X-AspNet-Version: 4.0.30319 X-Powered-By: ASP.NET Date: Wed, 13 Apr 2016 11:28:21 GMT Age: 1 Connection: keep-alive

    DNS

    host: advancebit.com
    1. class: IN
    2. ttl: 600
    3. type: A
    4. ip: 184.168.221.58
    host: advancebit.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns41.domaincontrol.com
    host: advancebit.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns42.domaincontrol.com
    host: advancebit.com
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: ns41.domaincontrol.com
    5. rname: dns.jomax.net
    6. serial: 2013061900
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 3600
    host: advancebit.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mailstore1.secureserver.net
    host: advancebit.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 0
    5. target: smtp.secureserver.net
    host: advancebit.com
    1. class: IN
    2. ttl: 3600
    3. type: TXT
    4. txt: google-site-verification=DgkBsWD43ZWAxNwmr6RiwdId9wb0pO2O9hEo4QocqT8
    5. entries: Array
    host: advancebit.com
    1. class: IN
    2. ttl: 3600
    3. type: TXT
    4. txt: google-site-verification=hXzZQAF7kiMMprcSV8_wSEnkDBp4-icgWNaCX9SyRfU
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.dvancebit.com, www.aodvancebit.com, www.odvancebit.com, www.apdvancebit.com, www.pdvancebit.com, www.a9dvancebit.com, www.9dvancebit.com, www.advancebit.com, www.dvancebit.com, www.aidvancebit.com, www.idvancebit.com, www.audvancebit.com, www.udvancebit.com, www.avancebit.com, www.adtvancebit.com, www.atvancebit.com, www.adgvancebit.com, www.agvancebit.com, www.adbvancebit.com, www.abvancebit.com, www.adxvancebit.com, www.axvancebit.com, www.adsvancebit.com, www.asvancebit.com, www.adfvancebit.com, www.afvancebit.com, www.advvancebit.com, www.avvancebit.com, www.adyvancebit.com, www.ayvancebit.com, www.adzvancebit.com, www.azvancebit.com, www.adavancebit.com, www.aavancebit.com, www.adevancebit.com, www.aevancebit.com, www.adrvancebit.com, www.arvancebit.com, www.adancebit.com, www.advyancebit.com, www.adyancebit.com, www.advzancebit.com, www.adzancebit.com, www.advhancebit.com, www.adhancebit.com, www.advnancebit.com, www.adnancebit.com, www.advmancebit.com, www.admancebit.com, www.advjancebit.com, www.adjancebit.com, www.advkancebit.com, www.adkancebit.com, www.adviancebit.com, www.adiancebit.com, www.advncebit.com, www.advaoncebit.com, www.advoncebit.com, www.advapncebit.com, www.advpncebit.com, www.adva9ncebit.com, www.adv9ncebit.com, www.advancebit.com, www.advncebit.com, www.advaincebit.com, www.advincebit.com, www.advauncebit.com, www.advuncebit.com, www.advacebit.com, www.advanncebit.com, www.advancebit.com, www.advanhcebit.com, www.advahcebit.com, www.advanjcebit.com, www.advajcebit.com, www.advankcebit.com, www.advakcebit.com, www.advanlcebit.com, www.advalcebit.com, www.advan cebit.com, www.adva cebit.com, www.advanebit.com, www.advancdebit.com, www.advandebit.com, www.advancrebit.com, www.advanrebit.com, www.advanctebit.com, www.advantebit.com, www.advancvebit.com, www.advanvebit.com, www.advancfebit.com, www.advanfebit.com, www.advancgebit.com, www.advangebit.com, www.advanchebit.com, www.advanhebit.com, www.advancnebit.com, www.advannebit.com, www.advancmebit.com, www.advanmebit.com, www.advancjebit.com, www.advanjebit.com, www.advancbit.com, www.advancexbit.com, www.advancxbit.com, www.advancesbit.com, www.advancsbit.com, www.advancewbit.com, www.advancwbit.com, www.advancerbit.com, www.advancrbit.com, www.advancefbit.com, www.advancfbit.com, www.advancevbit.com, www.advancvbit.com, www.advancecbit.com, www.advanccbit.com, www.advanceqbit.com, www.advancqbit.com, www.advanceabit.com, www.advancabit.com, www.advanceybit.com, www.advancybit.com, www.advanceit.com, www.advancebqit.com, www.advanceqit.com, www.advancebwit.com, www.advancewit.com, www.advancebzit.com, www.advancezit.com, www.advancebxit.com, www.advancexit.com, www.advancebit.com, www.advanceit.com, www.advancebsit.com, www.advancesit.com, www.advancebyit.com, www.advanceyit.com, www.advancebeit.com, www.advanceeit.com, www.advancebdit.com, www.advancedit.com, www.advancebcit.com, www.advancecit.com, www.advancebt.com, www.advancebirt.com, www.advancebrt.com, www.advancebift.com, www.advancebft.com, www.advancebivt.com, www.advancebvt.com, www.advancebikt.com, www.advancebkt.com, www.advancebi,t.com, www.advanceb,t.com, www.advancebibt.com, www.advancebbt.com, www.advancebigt.com, www.advancebgt.com, www.advancebitt.com, www.advancebtt.com, www.advancebiyt.com, www.advancebyt.com, www.advancebiut.com, www.advancebut.com, www.advancebijt.com, www.advancebjt.com, www.advancebimt.com, www.advancebmt.com, www.advancebint.com, www.advancebnt.com,

    Other websites we recently analyzed

    1. Overview
      Brea (United States) - 208.113.204.237
      Server software: Apache
      Technology: CSS, Html, Iframe, Javascript, jQuery, Google Tagmanager
      Number of Javascript: 22
      Number of meta tags: 4
    2. Van Ruijven IT
      Van Ruijven IT is uw partner in software consultancy waaronder project-, service- en contractmanagement
      Netherlands - 85.158.203.165
      Server software: Apache
      Technology: CSS, Html, Php, Facebook Box, Twitter Button
      Number of meta tags: 3
    3. honeydewacres.com
      Switzerland - 141.8.225.124
      Server software: Apache
      Technology: Html
    4. Plavky 2015 | Plavkyzráje.cz
      Vyberte si u nás své nové a moderní plavky. Nabízíme nejnovější modely plavek z kolekce pro rok 2015. Vybrat si můžete dámské, pánské i dětské plavky.
      Czech Republic - 109.123.220.62
      G Analytics ID: UA-44178122-1
      Server software: Apache/2.4.7 (Ubuntu)
      Technology: DoubleClick.Net, CSS, Html, Iframe, Javascript, jQuery, Php, Google Analytics, Google AdWords Conversion Tracking, Google Remarketing, Google Tagmanager
      Number of Javascript: 12
      Number of meta tags: 7
    5. 时尚周-时尚门户网站
      Hong Kong - 103.255.177.91
      Server software: squid/3.5.12
      Technology: CSS, Html, Javascript
      Number of Javascript: 3
      Number of meta tags: 3
    6. TT 2012 May 18th
      United Kingdom - 79.171.34.42
      Server software: Microsoft-IIS/6.0
      Technology: CSS, Html, Swf Object
      Number of meta tags: 1
    7. Forever Living Products Germany
      Germany - 62.146.64.106
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, jQuery UI, Lightbox, Php, SVG
      Number of Javascript: 15
      Number of meta tags: 7
    8. selfreliantlivingmarketplace.com
      Scottsdale (United States) - 184.168.221.96
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    9. Agence web, création de sites internet à Paris
      Agence web à Paris Studio de conception et réalisation de sites internet, Paris Web Studio est une agence de communication digitale au service des entreprises
      France - 37.187.65.16
      Server software: Apache
      Technology: CSS, Font Awesome, Html, Html5, Javascript, jQuery, Php, Pingback, Revslider, Google Analytics, Wordpress
      Number of Javascript: 18
      Number of meta tags: 10
    10. MoDem78 | Mouvement Démocrate des Yvelines
      France - 213.186.33.82
      Server software: Apache
      Technology: CSS, Google Font API, Html, Html5, Iframe, Javascript, jQuery, Php, Pingback, Google Analytics, Wordpress, Facebook Box
      Number of Javascript: 9
      Number of meta tags: 3

    Check Other Websites